PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094538.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 236aa    MW: 27255.1 Da    PI: 4.8618
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094538.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.34.9e-4341341127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                     lp GfrF Pt+eelv++yL++k+++++ e++++i+ +diy+++P+dLp+       a+ ++w+fF++r++++a+g r+nr t++gyWkatg+ ++
  XP_011094538.1   4 LPTGFRFYPTEEELVSFYLHNKLNASRPEIDRIIPLLDIYHYNPSDLPQlggeYSPADAEQWFFFIPRQEREARGGRPNRLTDRGYWKATGSPTN 98 
                     699***************************999***************656654444778*********************************** PP

             NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                     v+s++++++g k+t+vfy grap+g++t W m+ey+
  XP_011094538.1  99 VYSSENRVIGRKRTMVFYVGRAPNGRRTVWKMNEYK 134
                     ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-433142IPR003441NAC domain
PROSITE profilePS5100543.7594160IPR003441NAC domain
PfamPF023658.8E-225134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDDLPTGFRF YPTEEELVSF YLHNKLNASR PEIDRIIPLL DIYHYNPSDL PQLGGEYSPA  60
DAEQWFFFIP RQEREARGGR PNRLTDRGYW KATGSPTNVY SSENRVIGRK RTMVFYVGRA  120
PNGRRTVWKM NEYKAIQTDK GTNNPMQNLQ NIKMLESFRQ ADHQHDDRHE AAADSTSNID  180
QHIVLPTITD WSLDSSSSGD PITVINPSQP AEMTSGNYQD MGSELFLDWE QLSWFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-29413717144NO APICAL MERISTEM PROTEIN
1ut4_B2e-29413717144NO APICAL MERISTEM PROTEIN
1ut7_A2e-29413717144NO APICAL MERISTEM PROTEIN
1ut7_B2e-29413717144NO APICAL MERISTEM PROTEIN
3swm_A2e-29413720147NAC domain-containing protein 19
3swm_B2e-29413720147NAC domain-containing protein 19
3swm_C2e-29413720147NAC domain-containing protein 19
3swm_D2e-29413720147NAC domain-containing protein 19
3swp_A2e-29413720147NAC domain-containing protein 19
3swp_B2e-29413720147NAC domain-containing protein 19
3swp_C2e-29413720147NAC domain-containing protein 19
3swp_D2e-29413720147NAC domain-containing protein 19
3ulx_A2e-29313414139Stress-induced transcription factor NAC1
4dul_A2e-29413717144NAC domain-containing protein 19
4dul_B2e-29413717144NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094538.11e-178PREDICTED: putative NAC domain-containing protein 61
TrEMBLA0A0S3RZ731e-75A0A0S3RZ73_PHAAN; Uncharacterized protein
STRINGGLYMA19G38211.18e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.14e-64NAC domain containing protein 61